PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_378F353CF.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 232aa    MW: 25565.5 Da    PI: 9.7581
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_378F353CF.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.61.5e-3176132158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  Traes_5AS_378F353CF.2  76 DAPIYVNAKQYEGILRRRRARAKAEKENRL-VKARKPYLHESRHLHAMRRARGSGGRF 132
                            68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.8E-3574135IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.0175135IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-2878132IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-2378100IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686080100IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.7E-23109132IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MVHLGSGKGG NSSEHSAPIT LQSPFTEYND HFELGLGQSV ISSNYYSDQQ YGLLSSYGMR  60
SASSGRMLIP LNMPADAPIY VNAKQYEGIL RRRRARAKAE KENRLVKARK PYLHESRHLH  120
AMRRARGSGG RFLNTKKETN GKDTGVGSKA MVGNPLMRSA ASLSSEIQHS EQGNPSSVSS  180
MSGSEVTSLY DHEDVDHYHN FEHLRTHFFT PLPSIMDGEH GAGNPFKWAA AS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-1876140266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A1e-1876134261HAPB protein
4g92_A1e-1876134261HAPB protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787560.0KM078756.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-A6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757443.11e-119PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-119PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_003577268.11e-119PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
SwissprotQ9M9X42e-38NFYA2_ARATH; Nuclear transcription factor Y subunit A-2
TrEMBLW5F4941e-172W5F494_WHEAT; Uncharacterized protein
STRINGMLOC_76757.21e-138(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.14e-29nuclear factor Y, subunit A2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]